PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02706.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 313aa    MW: 35093.8 Da    PI: 6.697
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02706.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-172572148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEde+lv  +++ G g+W++ +++ g+ R++k+c++rw +yl
  Rsa1.0_02706.1_g00003.1 25 RGPWTAEEDEILVSFIEKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 72
                             89******************************99************97 PP

2Myb_DNA-binding48.12.8e-1579123248
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              g  T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Rsa1.0_02706.1_g00003.1  79 GGITLDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 123
                              55699****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-221675IPR009057Homeodomain-like
PROSITE profilePS5129416.5172072IPR017930Myb domain
SuperFamilySSF466892.43E-2921119IPR009057Homeodomain-like
SMARTSM007171.4E-132474IPR001005SANT/Myb domain
PfamPF002493.9E-152572IPR001005SANT/Myb domain
CDDcd001679.39E-122772No hitNo description
PROSITE profilePS5129423.81873127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2376127IPR009057Homeodomain-like
SMARTSM007171.1E-1477125IPR001005SANT/Myb domain
PfamPF002496.7E-1481123IPR001005SANT/Myb domain
CDDcd001677.37E-1282123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTSSGVKKQV TKKTSPCCMK MGMKRGPWTA EEDEILVSFI EKEGEGRWRS LPKRAGLLRC  60
GKSCRLRWMN YLRPTVKRGG ITLDEEDLIL RLHRLLGNRW SLIAGRIPGR TDNEIKNYWN  120
THLRKKLLSQ GIDPQTHKPL DADHKPGEEV SAGQNLLEPN SSSHTDVTTV SSGNGASKIS  180
FSFLVWIRLL GAIPGSAQFH YNPEKDIFSY GSTTSHLDLP YSACFMKIPS CCTCVFYFPA  240
FQLASICFFG GEDDEDFGFC YDDKFSSFLN ALINDDPVDS NIPISQPFRM QDCTDEIVGT  300
SSSLEHGQSL EDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-272312725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009124751.11e-129PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-111MYB5_ARATH; Transcription repressor MYB5
TrEMBLM4FE741e-129M4FE74_BRARP; Uncharacterized protein
STRINGBra039395.1-P1e-128(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-100myb domain protein 5